Lalitha Sahasranamam Lyrics in English, With Meaning

Lalitha Sahasranamam lyrics and meaning

Below are the 185 passages of Lalitha Sahasranamam as sung in the recording Diya plays, in the order they are sung. Each row gives the words in English letters under the original script, and their meaning in English.

Words (original script and transliteration)	Meaning in English
ॐ Om	Om.
अरुणां करुणातरङ्गिताक्षीं धृतपाशाङ्कुशपुष्पबाणचापाम् अणिमादिभिरावृतां मयूखैर् अहमित्येव विभावये भवानीम् Arunaam karunaatarangitaaksheem Dhritapaashaankushapushpabaanachaapaam Animaadibhiraavritaam mayookhair Ahamityeva vibhaavaye bhavaaneem	I contemplate Bhavani as my very self: crimson, her eyes rippling with compassion, holding a noose, goad, flower arrows and bow. Powers such as becoming infinitesimal surround her as rays of light.
श्रीमाता श्रीमहाराज्ञी श्रीमत्सिंहासनेश्वरी चिदग्निकुण्डसम्भूता देवकार्यसमुद्यता Shreemaataa shreemahaaraajnyee shreematsimhaasaneshvaree Chidagnikundasambhootaa devakaaryasamudyataa	She is the glorious Mother, the great Empress, and ruler of the splendid throne. She arises from the fire-pit of consciousness and stands ready to accomplish the gods' purpose.
उद्यद्भानुसहस्राभा चतुर्बाहुसमन्विता रागस्वरूपपाशाढ्या क्रोधाकाराङ्कुशोज्ज्वला Udyadbhaanusahasraabhaa chaturbaahusamanvitaa Raagasvaroopapaashaadhyaa krodhaakaaraankushojjvalaa	She shines like a thousand rising suns and has four arms. Her noose takes the form of attachment, and her gleaming goad takes the form of anger.
मनोरूपेक्षुकोदण्डा पञ्चतन्मात्रसायका निजारुणप्रभापूरमज्जद्ब्रह्माण्डमण्डला Manoroopekshukodandaa panchatanmaatrasaayakaa Nijaarunaprabhaapooramajjadbrahmaandamandalaa	Her sugarcane bow is the mind; her arrows are the five subtle qualities of sensation. The flood of her own crimson light immerses the entire cosmic sphere.
चम्पकाशोकपुन्नागसौगन्धिकलसत्कचा कुरुविन्दमणिश्रेणीकनत्कोटीरमण्डिता Champakaashokapunnaagasaugandhikalasatkachaa Kuruvindamanishreneekanatkoteeramanditaa	Her hair shines with champaka, ashoka, punnaga and saugandhika flowers. A brilliant crown set with rows of ruby gems adorns her.
अष्टमीचन्द्रविभ्राजदलिकस्थलशोभिता मुखचन्द्रकलङ्काभमृगनाभिविशेषका Ashtameechandravibhraajadalikasthalashobhitaa Mukhachandrakalankaabhamriganaabhivisheshakaa	Her forehead gleams like the moon on the eighth lunar day. The musk mark on her moonlike face resembles the moon's dark marking.
वदनस्मरमाङ्गल्यगृहतोरणचिल्लिका वक्त्रलक्ष्मीपरीवाहचलन्मीनाभलोचना Vadanasmaramaangalyagrihatoranachillikaa Vaktralakshmeepareevaahachalanmeenaabhalochanaa	Her eyebrows are the entrance arch of Kama's auspicious dwelling, her face. Her eyes resemble fish moving through the overflowing stream of her face's beauty.
नवचम्पकपुष्पाभनासादण्डविराजिता ताराकान्तितिरस्कारिनासाभरणभासुरा Navachampakapushpaabhanaasaadandaviraajitaa Taaraakaantitiraskaarinaasaabharanabhaasuraa	Her nose has the beauty of a freshly opened champaka blossom. Her shining nose ornament outdoes the brilliance of the stars.
कदम्बमञ्जरीकॢप्तकर्णपूरमनोहरा ताटङ्कयुगलीभूततपनोडुपमण्डला Kadambamanjareekliptakarnapooramanoharaa Taatankayugaleebhootatapanodupamandalaa	Clusters of kadamba flowers worn at her ears make her enchanting. The discs of the sun and moon form her two earrings.
पद्मरागशिलादर्शपरिभाविकपोलभूः नवविद्रुमबिम्बश्रीन्यक्कारिरदनच्छदा Padmaraagashilaadarshaparibhaavikapolabhooh Navavidrumabimbashreenyakkaariradanachchhadaa	Her cheeks surpass mirrors made of ruby. The beauty of her lips puts fresh coral and red bimba fruit to shame.
शुद्धविद्याङ्कुराकारद्विजपङ्क्तिद्वयोज्ज्वला कर्पूरवीटिकामोदसमाकर्षद्दिगन्तरा Shuddhavidyaankuraakaaradvijapanktidvayojjvalaa Karpooraveetikaamodasamaakarshaddigantaraa	Her two shining rows of teeth look like sprouts of pure knowledge. The fragrance of her camphor-flavored betel draws all directions toward her.
निजसल्लापमाधुर्यविनिर्भर्त्सितकच्छपी मन्दस्मितप्रभापूरमज्जत्कामेशमानसा Nijasallaapamaadhuryavinirbhartsitakachchhapee Mandasmitaprabhaapooramajjatkaameshamaanasaa	The sweetness of her conversation surpasses Kachchhapi, Sarasvati's vina. The radiance of her gentle smile floods Kamesha's mind.
अनाकलितसादृश्यचिबुकश्रीविराजिता कामेशबद्धमाङ्गल्यसूत्रशोभितकन्धरा Anaakalitasaadrishyachibukashreeviraajitaa Kaameshabaddhamaangalyasootrashobhitakandharaa	The beauty of her chin has no imaginable equal. Her neck is adorned with the auspicious marriage thread tied by Kamesha.
कनकाङ्गदकेयूरकमनीयभुजान्विता रत्नग्रैवेयचिन्ताकलोलमुक्ताफलान्विता Kanakaangadakeyoorakamaneeyabhujaanvitaa Ratnagraiveyachintaakalolamuktaaphalaanvitaa	Golden bracelets and armlets make her arms lovely. Her jeweled necklace and chintaka pendant are adorned with swaying pearls.
कामेश्वरप्रेमरत्नमणिप्रतिपणस्तनी नाभ्यालवालरोमालीलताफलकुचद्वयी Kaameshvarapremaratnamanipratipanastanee Naabhyaalavaalaromaaleelataaphalakuchadvayee	Her breasts are the return given for the precious jewel of Kameshvara's love. Her two breasts are fruits on the vine of fine hair rooted in the planting-basin of her navel.
लक्ष्यरोमलताधारतासमुन्नेयमध्यमा स्तनभारदलन्मध्यपट्टबन्धवलित्रया Lakshyaromalataadhaarataasamunneyamadhyamaa Stanabhaaradalanmadhyapattabandhavalitrayaa	Her waist is so slight that its existence is inferred from supporting the visible vine of hair. Three folds gird her waist like bands bracing it against the crushing weight of her breasts.
अरुणारुणकौसुम्भवस्त्रभास्वत्कटीतटी रत्नकिङ्किणिकारम्यरशनादामभूषिता Arunaarunakausumbhavastrabhaasvatkateetatee Ratnakinkinikaaramyarashanaadaamabhooshitaa	Her hips gleam beneath a deeply crimson garment dyed with safflower. A lovely jeweled girdle with tiny bells adorns her.
कामेशज्ञातसौभाग्यमार्दवोरुद्वयान्विता माणिक्यमुकुटाकारजानुद्वयविराजिता Kaameshajnyaatasaubhaagyamaardavorudvayaanvitaa Maanikyamukutaakaarajaanudvayaviraajitaa	The beauty and softness of her two thighs are known to Kamesha. Her two knees shine like crowns of ruby.
इन्द्रगोपपरिक्षिप्तस्मरतूणाभजङ्घिका गूढगुल्फा कूर्मपृष्ठजयिष्णुप्रपदान्विता Indragopaparikshiptasmaratoonaabhajanghikaa Goodhagulphaa koormaprishthajayishnuprapadaanvitaa	Her calves resemble Kama's quiver encircled with indragopa insects. Her ankles are concealed, and her arched forefeet surpass a tortoise's back.
नखदीधितिसञ्छन्ननमज्जनतमोगुणा पदद्वयप्रभाजालापराकृतसरोरुहा Nakhadeedhitisanchhannanamajjanatamogunaa Padadvayaprabhaajaalaaparaakritasaroruhaa	The brilliance of her toenails overwhelms the darkness in those who bow to her. The spreading radiance of her two feet outshines lotuses.
शिञ्जानमणिमञ्जीरमण्डितश्रीपदाम्बुजा मरालीमन्दगमना महालावण्यशेवधिः Shinjaanamanimanjeeramanditashreepadaambujaa Maraaleemandagamanaa mahaalaavanyashevadhih	Tinkling jeweled anklets adorn her auspicious lotus feet. She moves slowly and gracefully like a female swan, a vast treasury of beauty.
सर्वारुणाऽनवद्याङ्गी सर्वाभरणभूषिता शिवकामेश्वराङ्कस्था शिवा स्वाधीनवल्लभा Sarvaarunaanavadyaangee sarvaabharanabhooshitaa Shivakaameshvaraankasthaa shivaa svaadheenavallabhaa	She is crimson throughout, flawless in every limb, and adorned with every ornament. She sits on Shiva Kameshvara's lap; she is Shivaa, the auspicious one, whose beloved is under her sway.
सुमेरुमध्यशृङ्गस्था श्रीमन्नगरनायिका चिन्तामणिगृहान्तस्था पञ्चब्रह्मासनस्थिता Sumerumadhyashringasthaa shreemannagaranaayikaa Chintaamanigrihaantasthaa panchabrahmaasanasthitaa	She dwells on Sumeru's central peak and rules the glorious city. She lives within a palace of wish-fulfilling gems, seated on a throne formed by the five Brahmas.
महापद्माटवीसंस्था कदम्बवनवासिनी सुधासागरमध्यस्था कामाक्षी कामदायिनी Mahaapadmaataveesamsthaa kadambavanavaasinee Sudhaasaagaramadhyasthaa kaamaakshee kaamadaayinee	She dwells in the great lotus forest and the kadamba grove, in the midst of the ocean of nectar. She is Kamakshi, whose eyes awaken desire, and the giver of what is desired.
देवर्षिगणसङ्घातस्तूयमानात्मवैभवा भण्डासुरवधोद्युक्तशक्तिसेनासमन्विता Devarshiganasanghaatastooyamaanaatmavaibhavaa Bhandaasuravadhodyuktashaktisenaasamanvitaa	Hosts of gods and sages praise her glory. She is accompanied by an army of Shaktis, divine powers preparing to kill Bhandasura.
सम्पत्करीसमारूढसिन्धुरव्रजसेविता अश्वारूढाधिष्ठिताश्वकोटिकोटिभिरावृता Sampatkareesamaaroodhasindhuravrajasevitaa Ashvaaroodhaadhishthitaashvakotikotibhiraavritaa	An elephant host, with Sampatkari mounted at its head, serves her. Countless crores of horses under Ashvarudha's command surround her.
चक्रराजरथारूढसर्वायुधपरिष्कृता गेयचक्ररथारूढमन्त्रिणीपरिसेविता Chakraraajarathaaroodhasarvaayudhaparishkritaa Geyachakrarathaaroodhamantrineeparisevitaa	She rides the Chakraraja chariot, equipped with every weapon. Mantrini, riding the Geyachakra chariot, attends her.
किरिचक्ररथारूढदण्डनाथापुरस्कृता ज्वालामालिनिकाक्षिप्तवह्निप्राकारमध्यगा Kirichakrarathaaroodhadandanaathaapuraskritaa Jvaalaamaalinikaakshiptavahnipraakaaramadhyagaa	Dandanatha goes before her in the Kirichakra chariot. She stands within the rampart of fire cast around her by Jvalamalini.
भण्डसैन्यवधोद्युक्तशक्तिविक्रमहर्षिता नित्यापराक्रमाटोपनिरीक्षणसमुत्सुका Bhandasainyavadhodyuktashaktivikramaharshitaa Nityaaparaakramaatopanireekshanasamutsukaa	She rejoices in the valor of the Shaktis preparing to destroy Bhanda's army. She eagerly watches the magnificent display of the Nitya goddesses' prowess.
भण्डपुत्रवधोद्युक्तबालाविक्रमनन्दिता मन्त्रिण्यम्बाविरचितविशङ्गवधतोषिता Bhandaputravadhodyuktabaalaavikramananditaa Mantrinyambaavirachitavishangavadhatoshitaa	Bala's valor in setting out to kill Bhanda's sons delights her. She is pleased by Mother Mantrini's killing of Vishanga.
विशुक्रप्राणहरणवाराहीवीर्यनन्दिता कामेश्वरमुखालोककल्पितश्रीगणेश्वरा Vishukrapraanaharanavaaraaheeveeryananditaa Kaameshvaramukhaalokakalpitashreeganeshvaraa	She delights in Varahi's valor in taking Vishukra's life. By looking at Kameshvara's face, she brings forth Shri Ganeshvara.
महागणेशनिर्भिन्नविघ्नयन्त्रप्रहर्षिता भण्डासुरेन्द्रनिर्मुक्तशस्त्रप्रत्यस्त्रवर्षिणी Mahaaganeshanirbhinnavighnayantrapraharshitaa Bhandaasurendranirmuktashastrapratyastravarshinee	She rejoices when Mahaganesha breaks the device that creates obstacles. She showers counter-weapons against the weapons released by Bhandasura, lord of the demons.
कराङ्गुलीनखोत्पन्ननारायणदशाकृतिः महापाशुपतास्त्राग्निनिर्दग्धासुरसैनिका Karaanguleenakhotpannanaaraayanadashaakritih Mahaapaashupataastraagninirdagdhaasurasainikaa	The ten forms of Narayana arise from her fingernails. The fire of her great Pashupata weapon burns the demon armies.
कामेश्वरास्त्रनिर्दग्धसभण्डासुरशून्यका ब्रह्मोपेन्द्रमहेन्द्रादिदेवसंस्तुतवैभवा Kaameshvaraastranirdagdhasabhandaasurashoonyakaa Brahmopendramahendraadidevasamstutavaibhavaa	Her Kameshvara weapon burns Shunyaka together with Bhandasura. Brahma, Upendra, Mahendra and the other gods praise her magnificence.
हरनेत्राग्निसन्दग्ध कामसञ्जीवनौषधिः श्रीमद्वाग्भवकूटैक स्वरूपमुखपङ्कजा Haranetraagnisandagdha kaamasanjeevanaushadhih Shreemadvaagbhavakootaika svaroopamukhapankajaa	She is the life-restoring medicine for Kama, burned by the fire from Hara's eye. Her lotus face is the glorious Vagbhava section of the mantra itself.
कण्ठाधःकटिपर्यन्त मध्यकूटस्वरूपिणी शक्तिकूटैकतापन्न कट्यधोभागधारिणी Kanthaadhahkatiparyanta madhyakootasvaroopinee Shaktikootaikataapanna katyadhobhaagadhaarinee	From below her neck to her waist, she embodies the mantra's middle section. The portion of her body below the waist is one with its Shakti section.
मूलमन्त्रात्मिका मूलकूटत्रयकलेवरा कुलामृतैकरसिका कुलसङ्केतपालिनी Moolamantraatmikaa moolakootatrayakalevaraa Kulaamritaikarasikaa kulasanketapaalinee	She is the root mantra itself, her body formed of its three sections. She delights especially in the nectar of Kula and preserves its secret conventions.
कुलाङ्गना कुलान्तःस्था कौलिनी कुलयोगिनी अकुला समयान्तःस्था समयाचारतत्परा Kulaanganaa kulaantahsthaa kaulinee kulayoginee Akulaa samayaantahsthaa samayaachaaratatparaa	She is the noble lady of Kula, dwelling within it, Kaulini and its yogini. She is also Akula, beyond Kula. She dwells within Samaya and is devoted to its practices.
मूलाधारैकनिलया ब्रह्मग्रन्थिविभेदिनी मणिपूरान्तरुदिता विष्णुग्रन्थिविभेदिनी Moolaadhaaraikanilayaa brahmagranthivibhedinee Manipooraantaruditaa vishnugranthivibhedinee	Her particular abode is Muladhara, the root center, and she pierces Brahma's knot. Arising within Manipura, she pierces Vishnu's knot.
आज्ञाचक्रान्तरालस्था रुद्रग्रन्थिविभेदिनी सहस्राराम्बुजारूढा सुधासाराभिवर्षिणी Aajnyaachakraantaraalasthaa rudragranthivibhedinee Sahasraaraambujaaroodhaa sudhaasaaraabhivarshinee	She dwells within the Ajna center and pierces Rudra's knot. She ascends the thousand-petaled lotus and showers the essence of nectar.
तटिल्लतासमरुचिः षट्चक्रोपरिसंस्थिता महासक्तिः कुण्डलिनी बिसतन्तुतनीयसी Tatillataasamaruchih shatchakroparisamsthitaa Mahaasaktih kundalinee bisatantutaneeyasee	She shines like a streak of lightning and dwells above the six centers. She is Mahasakti, great attachment, and Kundalini, the coiled one, finer than a lotus-stalk fiber.
भवानी भावनागम्या भवारण्यकुठारिका भद्रप्रिया भद्रमूर्तिर् भक्तसौभाग्यदायिनी Bhavaanee bhaavanaagamyaa bhavaaranyakuthaarikaa Bhadrapriyaa bhadramoortir bhaktasaubhaagyadaayinee	She is Bhavani, reached through contemplation, an axe against the forest of worldly existence. She loves auspiciousness, embodies it, and grants her devotees good fortune.
भक्तिप्रिया भक्तिगम्या भक्तिवश्या भयापहा शाम्भवी शारदाराध्या शर्वाणी शर्मदायिनी Bhaktipriyaa bhaktigamyaa bhaktivashyaa bhayaapahaa Shaambhavee shaaradaaraadhyaa sharvaanee sharmadaayinee	She cherishes devotion, is reached through devotion, and is won over by devotion; she removes fear. She is Shambhavi, Shiva's consort, worshiped by Sharada, and Sharvani, the giver of happiness.
शाङ्करी श्रीकरी साध्वी शरच्चन्द्रनिभानना शातोदरी शान्तिमती निराधारा निरञ्जना Shaankaree shreekaree saadhvee sharachchandranibhaananaa Shaatodaree shaantimatee niraadhaaraa niranjanaa	She is Shankari, Shiva's consort, the giver of prosperity, virtuous and faithful, with a face like the autumn moon. Her belly is slender; she is peaceful, rests on no support, and is unstained.
निर्लेपा निर्मला नित्या निराकारा निराकुला निर्गुणा निष्कला शान्ता निष्कामा निरुपप्लवा Nirlepaa nirmalaa nityaa niraakaaraa niraakulaa Nirgunaa nishkalaa shaantaa nishkaamaa nirupaplavaa	She is untouched, stainless, eternal, without form or agitation. She is beyond the qualities of nature, without parts, peaceful, free of desire, and untouched by disturbance.
नित्यमुक्ता निर्विकारा निष्प्रपञ्चा निराश्रया नित्यशुद्धा नित्यबुद्धा निरवद्या निरन्तरा Nityamuktaa nirvikaaraa nishprapanchaa niraashrayaa Nityashuddhaa nityabuddhaa niravadyaa nirantaraa	She is always free, unchanging, beyond the manifold world, and dependent on nothing. She is eternally pure, eternally awakened, faultless and uninterrupted.
निष्कारणा निष्कलङ्का निरुपाधिर्निरीश्वरा नीरागा रागमथनी निर्मदा मदनाशिनी Nishkaaranaa nishkalankaa nirupaadhirnireeshvaraa Neeraagaa raagamathanee nirmadaa madanaashinee	She has no cause, no blemish, no limiting condition and no lord above her. She is free of attachment and breaks attachment; free of pride, she destroys pride.
निश्चिन्ता निरहङ्कारा निर्मोहा मोहनाशिनी निर्ममा ममताहन्त्री निष्पापा पापनाशिनी Nishchintaa nirahankaaraa nirmohaa mohanaashinee Nirmamaa mamataahantree nishpaapaa paapanaashinee	She is without anxiety or ego, free of delusion and its destroyer. She has no sense of 'mine' and ends possessiveness; sinless herself, she destroys sin.
निष्क्रोधा क्रोधशमनी निर्लोभालोभनाशिनी निःसंशया संशयघ्नी निर्भवा भवनाशिनी Nishkrodhaa krodhashamanee nirlobhaalobhanaashinee Nihsamshayaa samshayaghnee nirbhavaa bhavanaashinee	She is free of anger and calms anger, free of greed and destroys greed. She is without doubt and ends doubt; she has no birth and brings the cycle of becoming to an end.
निर्विकल्पा निराबाधा निर्भेदा भेदनाशिनी निर्नाशा मृत्युमथनी निष्क्रिया निष्परिग्रहा Nirvikalpaa niraabaadhaa nirbhedaa bhedanaashinee Nirnaashaa mrityumathanee nishkriyaa nishparigrahaa	She is beyond conceptual divisions, free of affliction, undivided and the destroyer of division. She cannot perish, overcomes death, is without action and without possessions.
निस्तुला नीलचिकुरा निरपाया निरत्यया दुर्लभा दुर्गमा दुर्गा दुःखहन्त्री सुखप्रदा Nistulaa neelachikuraa nirapaayaa niratyayaa Durlabhaa durgamaa durgaa duhkhahantree sukhapradaa	She is incomparable, with dark blue-black hair, beyond harm, whose authority cannot be overstepped. She is difficult to attain, difficult to approach, Durga herself, who destroys sorrow and gives happiness.
दुष्टदूरा दुराचारशमनी दोषवर्जिता सर्वज्ञासान्द्रकरुणा समानाधिकवर्जिता Dushtadooraa duraachaarashamanee doshavarjitaa Sarvajnyaasaandrakarunaa samaanaadhikavarjitaa	She is far from the wicked, restrains harmful conduct, and has no faults. She knows all, is filled with compassion, and has neither equal nor superior.
सर्वशक्तिमयी सर्वमङ्गला सद्गतिप्रदा सर्वेश्वरी सर्वमयी सर्वमन्त्रस्वरूपिणी Sarvashaktimayee sarvamangalaa sadgatipradaa Sarveshvaree sarvamayee sarvamantrasvaroopinee	She embodies every power and every blessing, and grants a blessed destination. She rules all, is all, and takes the form of every mantra.
सर्वयन्त्रात्मिका सर्वतन्त्ररूपा मनोन्मनी माहेश्वरी महादेवी महालक्ष्मीर्मृडप्रिया Sarvayantraatmikaa sarvatantraroopaa manonmanee Maaheshvaree mahaadevee mahaalakshmeermridapriyaa	She is the essence of every yantra and the form of every tantra, Manonmani, beyond the mind. She is Maheshvari, the great Goddess, Mahalakshmi and the beloved of Mrida, Shiva.
महारूपा महापूज्या महापातकनाशिनी महामाया महासत्त्वा महाशक्तिर्महारतिः Mahaaroopaa mahaapoojyaa mahaapaatakanaashinee Mahaamaayaa mahaasattvaa mahaashaktirmahaaratih	Her form is great, she deserves great worship, and she destroys grave sins. She is the great power of appearance, the great being, great power itself and great delight.
महाभोगा महैश्वर्या महावीर्या महाबला महाबुद्धिर्महासिद्धिर्महायोगेश्वरेश्वरी Mahaabhogaa mahaishvaryaa mahaaveeryaa mahaabalaa Mahaabuddhirmahaasiddhirmahaayogeshvareshvaree	Great are her enjoyment and sovereignty, her vigor and strength, her intelligence and accomplishment. She rules over the great lords of yoga.
महातन्त्रा महामन्त्रा महायन्त्रा महासना महायागक्रमाराध्या महाभैरवपूजिता Mahaatantraa mahaamantraa mahaayantraa mahaasanaa Mahaayaagakramaaraadhyaa mahaabhairavapoojitaa	She is the great tantra, the great mantra, the great yantra, and she has the great seat. She is worshiped through the sequence of the great sacrifice and is adored by Mahabhairava.
महेश्वरमहाकल्पमहाताण्डवसाक्षिणी महाकामेशमहिषी महात्रिपुरसुन्दरी Maheshvaramahaakalpamahaataandavasaakshinee Mahaakaameshamahishee mahaatripurasundaree	She witnesses Maheshvara's great tandava dance at the great cosmic dissolution. She is the queen of Mahakamesha and Mahatripurasundari, the great Beauty of the Three Cities.
चतुष्षष्ट्युपचाराढ्या चतुष्षष्टिकलामयी महाचतुष्षष्टिकोटियोगिनीगणसेविता Chatushshashtyupachaaraadhyaa chatushshashtikalaamayee Mahaachatushshashtikotiyogineeganasevitaa	She abounds in the sixty-four forms of ritual service and embodies the sixty-four arts. Hosts of sixty-four crore great yoginis attend her.
मनुविद्या चन्द्रविद्या चन्द्रमण्डलमध्यगा चारुरूपा चारुहासा चारुचन्द्रकलाधरा Manuvidyaa chandravidyaa chandramandalamadhyagaa Chaaruroopaa chaaruhaasaa chaaruchandrakalaadharaa	She embodies Manuvidya and Chandravidya, the mantra forms associated with Manu and Chandra, and dwells at the center of the moon's disc. Her form, smile and the crescent moon she bears are beautiful.
चराचरजगन्नाथा चक्रराजनिकेतना पार्वती पद्मनयना पद्मरागसमप्रभा Charaacharajagannaathaa chakraraajaniketanaa Paarvatee padmanayanaa padmaraagasamaprabhaa	She rules the world of moving and unmoving beings and dwells in Chakraraja, the supreme chakra. She is Parvati, lotus-eyed, shining like ruby.
पञ्चप्रेतासनासीना पञ्चब्रह्मस्वरूपिणी चिन्मयी परमानन्दा विज्ञानघनरूपिणी Panchapretaasanaaseenaa panchabrahmasvaroopinee Chinmayee paramaanandaa vijnyaanaghanaroopinee	She sits on a throne of five corpses and embodies the five Brahmas. She is consciousness itself, supreme bliss, and undivided knowing.
ध्यानध्यातृध्येयरूपा धर्माधर्मविवर्जिता Dhyaanadhyaatridhyeyaroopaa dharmaadharmavivarjitaa	She is meditation, the one who meditates, and what is meditated upon. She is beyond dharma and adharma, merit and demerit.
विश्वरूपा जागरिणी स्वपन्ती तैजसात्मिका सुप्ता प्राज्ञात्मिका तुर्या सर्वावस्थाविवर्जिता Vishvaroopaa jaagarinee svapantee taijasaatmikaa Suptaa praajnyaatmikaa turyaa sarvaavasthaavivarjitaa	Lalita embodies the universe and the consciousness of waking, dreaming, and deep sleep. She is also Turiya, beyond every state.
सृष्टिकर्त्री ब्रह्मरूपा गोप्त्री गोविन्दरूपिणी संहारिणी रुद्ररूपा तिरोधानकरीश्वरी सदाशिवानुग्रहदा पञ्चकृत्यपरायणा Srishtikartree brahmaroopaa goptree govindaroopinee Samhaarinee rudraroopaa tirodhaanakareeshvaree Sadaashivaanugrahadaa panchakrityaparaayanaa	She creates as Brahma and protects as Govinda. She dissolves as Rudra, brings concealment as Ishvari, and bestows grace as Sadashiva. She carries out these five acts.
भानुमण्डलमध्यस्था भैरवी भगमालिनी पद्मासना भगवती पद्मनाभसहोदरी Bhaanumandalamadhyasthaa bhairavee bhagamaalinee Padmaasanaa bhagavatee padmanaabhasahodaree	She dwells at the center of the sun's orb. She is Bhairavi and Bhagamalini, seated on a lotus, the blessed Bhagavati, and sister of Padmanabha.
उन्मेषनिमिषोत्पन्नविपन्नभुवनावली सहस्रशीर्षवदना सहस्राक्षी सहस्रपात् Unmeshanimishotpannavipannabhuvanaavalee Sahasrasheershavadanaa sahasraakshee sahasrapaat	Her opening and closing of the eyes brings whole successions of worlds into being and ends them. She has a thousand heads and faces, a thousand eyes, and a thousand feet.
आब्रह्मकीटजननी वर्णाश्रमविधायिनी निजाज्ञारूपनिगमा पुण्यापुण्यफलप्रदा Aabrahmakeetajananee varnaashramavidhaayinee Nijaajnyaaroopanigamaa punyaapunyaphalapradaa	Mother of beings from Brahma to insects, Lalita establishes the social orders and life stages; the Vedas express her command, and deeds bear fruit through her.
श्रुतिसीमन्तसिन्दूरीकृतपादाब्जधूलिका सकलागमसन्दोहशुक्तिसम्पुटमौक्तिका Shrutiseemantasindooreekritapaadaabjadhoolikaa Sakalaagamasandohashuktisamputamauktikaa	The Vedas wear her foot-dust as vermilion; all the Agamas form the oyster shell that holds her as its pearl.
पुरुषार्थप्रदा पूर्णा भोगिनी भुवनेश्वरी अम्बिकाऽनादिनिधना हरिब्रह्मेन्द्रसेविता Purushaarthapradaa poornaa bhoginee bhuvaneshvaree Ambikaanaadinidhanaa haribrahmendrasevitaa	Lalita grants life's aims. Complete and without beginning or end, she is Mother Ambika, ruler of the worlds, served by Hari, Brahma, and Indra.
नारायणी नादरूपा नामरूपविवर्जिता ह्रीङ्कारी ह्रीमती हृद्या हेयोपादेयवर्जिता Naaraayanee naadaroopaa naamaroopavivarjitaa Hreenkaaree hreematee hridyaa heyopaadeyavarjitaa	She is Narayani, the form of sacred sound, beyond name and form. She embodies Hrim, is modest and dear to the heart, and is beyond anything to be rejected or accepted.
राजराजार्चिता राज्ञी रम्या राजीवलोचना रञ्जनी रमणी रस्या रणत्किङ्किणिमेखला Raajaraajaarchitaa raajnyee ramyaa raajeevalochanaa Ranjanee ramanee rasyaa ranatkinkinimekhalaa	Worshipped by Rajaraja, the king of kings, she is the queen, lovely and lotus-eyed. She delights, enchants, and is full of savor; her girdle is strung with tinkling bells.
रमा राकेन्दुवदना रतिरूपा रतिप्रिया रक्षाकरी राक्षसघ्नी रामा रमणलम्पटा Ramaa raakenduvadanaa ratiroopaa ratipriyaa Rakshaakaree raakshasaghnee raamaa ramanalampataa	Full-moon-faced Rama embodies love's delight. She protects, slays rakshasas, and passionately desires her beloved.
काम्या कामकलारूपा कदम्बकुसुमप्रिया कल्याणी जगतीकन्दा करुणारससागरा Kaamyaa kaamakalaaroopaa kadambakusumapriyaa Kalyaanee jagateekandaa karunaarasasaagaraa	She is desirable, embodies Kamakala, the creative potency of desire, and loves kadamba blossoms. Auspicious, she is the root of the universe and an ocean of compassion.
कलावती कलालापा कान्ता कादम्बरीप्रिया वरदा वामनयना वारुणीमदविह्वला Kalaavatee kalaalaapaa kaantaa kaadambareepriyaa Varadaa vaamanayanaa vaaruneemadavihvalaa	She possesses the arts, speaks melodiously, is lovely, and delights in kadambari wine. She grants boons, has beautiful eyes, and is overcome by the intoxication of varuni wine.
विश्वाधिका वेदवेद्या विन्ध्याचलनिवासिनी विधात्री वेदजननी विष्णुमाया विलासिनी Vishvaadhikaa vedavedyaa vindhyaachalanivaasinee Vidhaatree vedajananee vishnumaayaa vilaasinee	She surpasses the universe and is known through the Vedas; she dwells in the Vindhya mountains. She orders creation, is mother of the Vedas, is Vishnu's maya, and delights in play.
क्षेत्रस्वरूपा क्षेत्रेशी क्षेत्रक्षेत्रज्ञपालिनी क्षयवृद्धिविनिर्मुक्ता क्षेत्रपालसमर्चिता Kshetrasvaroopaa kshetreshee kshetrakshetrajnyapaalinee Kshayavriddhivinirmuktaa kshetrapaalasamarchitaa	She is the field of embodied experience and its sovereign, protecting both the field and its knower. Free from decline and growth, she is worshipped by Kshetrapala, guardian of the field.
विजया विमला वन्द्या वन्दारुजनवत्सला वाग्वादिनी वामकेशी वह्निमण्डलवासिनी Vijayaa vimalaa vandyaa vandaarujanavatsalaa Vaagvaadinee vaamakeshee vahnimandalavaasinee	Victorious, stainless, and worthy of reverence, she loves those who bow to her. She gives voice to speech, has beautiful hair, and dwells in the circle of fire.
भक्तिमत्कल्पलतिका पशुपाशविमोचिनी संहृताशेषपाषण्डा सदाचारप्रवर्तिका Bhaktimatkalpalatikaa pashupaashavimochinee Samhritaasheshapaashandaa sadaachaarapravartikaa	She is the wish-fulfilling vine for devotees and releases bound beings from their fetters. She destroys all heretics and sets right conduct in motion.
तापत्रयाग्निसन्तप्तसमाह्लादनचन्द्रिका तरुणी तापसाराध्या तनुमध्या तमोऽपहा Taapatrayaagnisantaptasamaahlaadanachandrikaa Tarunee taapasaaraadhyaa tanumadhyaa tamopahaa	She is cooling moonlight for those scorched by the fire of the three kinds of suffering. Youthful and slender-waisted, she is worshipped by ascetics and removes darkness.
चितिस्तत्पदलक्ष्यार्था चिदेकरसरूपिणी स्वात्मानन्दलवीभूतब्रह्माद्यानन्दसन्ततिः Chitistatpadalakshyaarthaa chidekarasaroopinee Svaatmaanandalaveebhootabrahmaadyaanandasantatih	Lalita is the consciousness meant by 'That.' Even the joys of Brahma and the other gods are only a drop of her inner bliss.
परा प्रत्यक्चितीरूपा पश्यन्ती परदेवता मध्यमा वैखरीरूपा भक्तमानसहंसिका Paraa pratyakchiteeroopaa pashyantee paradevataa Madhyamaa vaikhareeroopaa bhaktamaanasahamsikaa	Lalita is speech from its inward source to its spoken form, the supreme deity and the swan within her devotees' minds.
कामेश्वरप्राणनाडी कृतज्ञा कामपूजिता शृङ्गाररससम्पूर्णा जया जालन्धरस्थिता Kaameshvarapraananaadee kritajnyaa kaamapoojitaa Shringaararasasampoornaa jayaa jaalandharasthitaa	She is Kameshvara's life-channel, recognizes deeds, and is worshipped by Kama. Filled with the savor of erotic love, she is victorious and dwells at Jalandhara.
ओड्याणपीठनिलया बिन्दुमण्डलवासिनी रहोयागक्रमाराध्या रहस्तर्पणतर्पिता Odyaanapeethanilayaa bindumandalavaasinee Rahoyaagakramaaraadhyaa rahastarpanatarpitaa	She dwells in the sacred seat of Oddiyana and in the bindu's central circle. She is worshipped through the ordered rites of secret sacrifice and satisfied by secret libations.
सद्यःप्रसादिनी विश्वसाक्षिणी साक्षिवर्जिता षडङ्गदेवतायुक्ता षाड्गुण्यपरिपूरिता Sadyahprasaadinee vishvasaakshinee saakshivarjitaa Shadangadevataayuktaa shaadgunyaparipooritaa	She is immediately gracious, witnesses the universe, and herself has no other witness. Accompanied by the deities of the six limbs, she is complete in the six divine excellences.
नित्यक्लिन्ना निरुपमा निर्वाणसुखदायिनी नित्याषोडशिकारूपा श्रीकण्ठार्धशरीरिणी Nityaklinnaa nirupamaa nirvaanasukhadaayinee Nityaashodashikaaroopaa shreekanthaardhashareerinee	She is Nityaklinna, ever moistened, incomparable, and giver of liberation's bliss. She has the form of the sixteen Nitya goddesses and shares half the body of Shrikantha, Shiva.
प्रभावती प्रभारूपा प्रसिद्धा परमेश्वरी मूलप्रकृतिरव्यक्ता व्यक्ताव्यक्तस्वरूपिणी Prabhaavatee prabhaaroopaa prasiddhaa parameshvaree Moolaprakritiravyaktaa vyaktaavyaktasvaroopinee	She possesses radiance and is radiance itself, renowned and the supreme sovereign. She is primordial nature, unmanifest, and the form of both the manifest and the unmanifest.
व्यापिनी विविधाकारा विद्याविद्यास्वरूपिणी महाकामेशनयनकुमुदाह्लादकौमुदी Vyaapinee vividhaakaaraa vidyaavidyaasvaroopinee Mahaakaameshanayanakumudaahlaadakaumudee	She pervades everything, takes many forms, and is both knowledge and ignorance. She is the moonlight that delights the water-lilies of Mahakamesha's eyes.
भक्तहार्दतमोभेदभानुमद्भानुसन्ततिः शिवदूती शिवाराध्या शिवमूर्त्तिः शिवङ्करी Bhaktahaardatamobhedabhaanumadbhaanusantatih Shivadootee shivaaraadhyaa shivamoorttih shivankaree	She is the sunlight that breaks the darkness in her devotees' hearts. She has Shiva as her messenger, is worshipped by Shiva, embodies Shiva, and brings auspiciousness.
शिवप्रिया शिवपरा शिष्टेष्टा शिष्टपूजिता अप्रमेया स्वप्रकाशा मनोवाचामगोचरा Shivapriyaa shivaparaa shishteshtaa shishtapoojitaa Aprameyaa svaprakaashaa manovaachaamagocharaa	Dear to Shiva and devoted to Shiva, she is loved and worshipped by the virtuous. She cannot be measured, shines by her own light, and lies beyond the reach of mind and speech.
चिच्छक्तिश्चेतनारूपा जडशक्तिर्जडात्मिका गायत्री व्याहृतिः सन्ध्या द्विजवृन्दनिषेविता Chichchhaktishchetanaaroopaa jadashaktirjadaatmikaa Gaayatree vyaahritih sandhyaa dvijavrindanishevitaa	Lalita is the power in conscious and insentient existence. She is Gayatri, the sacred utterances, and Sandhya, served by the twice-born.
तत्त्वासना तत्त्वमयी पञ्चकोशान्तरस्थिता निस्सीममहिमा नित्ययौवना मदशालिनी Tattvaasanaa tattvamayee panchakoshaantarasthitaa Nisseemamahimaa nityayauvanaa madashaalinee	The principles of reality are her seat and her substance; she dwells within the five sheaths. Her glory is boundless, her youth everlasting, and she is filled with intoxication.
मदघूर्णितरक्ताक्षी मदपाटलगण्डभूः चन्दनद्रवदिग्धाङ्गी चाम्पेयकुसुमप्रिया Madaghoornitaraktaakshee madapaatalagandabhooh Chandanadravadigdhaangee chaampeyakusumapriyaa	Her reddened eyes roll with intoxication, and her cheeks are rosy with it. Her body is anointed with liquid sandalwood paste, and champaka blossoms are dear to her.
कुशला कोमलाकारा कुरुकुल्ला कुलेश्वरी कुलकुण्डालया कौलमार्गतत्परसेविता Kushalaa komalaakaaraa kurukullaa kuleshvaree Kulakundaalayaa kaulamaargatatparasevitaa	Skillful and tender in form, she is Kurukulla and Kuleshvari, ruler of Kula. She dwells in Kulakunda, the Kula center, and is served by those devoted to the Kaula path.
कुमारगणनाथाम्बा तुष्टिः पुष्टिर्मतिर्धृतिः शान्तिः स्वस्तिमती कान्तिर्नन्दिनी विघ्ननाशिनी Kumaaragananaathaambaa tushtih pushtirmatirdhritih Shaantih svastimatee kaantirnandinee vighnanaashinee	She is mother of Kumara and Gananatha, contentment, nourishment, intelligence, and steadiness. She is peace, possesses well-being, is radiance, brings delight, and destroys obstacles.
तेजोवती त्रिनयना लोलाक्षी कामरूपिणी मालिनी हंसिनी माता मलयाचलवासिनी Tejovatee trinayanaa lolaakshee kaamaroopinee Maalinee hamsinee maataa malayaachalavaasinee	Radiant and three-eyed, with moving eyes, she takes whatever form she desires. Garlanded, she is Hamsini, the swan, the Mother who dwells on Mount Malaya.
सुमुखी नलिनी सुभ्रूः शोभना सुरनायिका कालकण्ठी कान्तिमती क्षोभिणी सूक्ष्मरूपिणी Sumukhee nalinee subhrooh shobhanaa suranaayikaa Kaalakanthee kaantimatee kshobhinee sookshmaroopinee	She has a lovely face, lotus-like beauty, graceful eyebrows, and splendor; she leads the gods. She is Kalakanthi, consort of the dark-throated Shiva, radiant, stirring all into motion, and subtle in form.
वज्रेश्वरी वामदेवी वयोऽवस्थाविवर्जिता सिद्धेश्वरी सिद्धविद्या सिद्धमाता यशस्विनी Vajreshvaree vaamadevee vayovasthaavivarjitaa Siddheshvaree siddhavidyaa siddhamaataa yashasvinee	She is Vajreshvari, lady of the thunderbolt, and Vamadevi, beyond the stages of aging. She rules the siddhas, is perfected sacred knowledge, mothers the siddhas, and is renowned.
विशुद्धिचक्रनिलया रक्तवर्णा त्रिलोचना खट्वाङ्गादिप्रहरणा वदनैकसमन्विता पायसान्नप्रिया त्वक्स्था पशुलोकभयङ्करी अमृतादिमहाशक्तिसंवृता डाकिनीश्वरी Vishuddhichakranilayaa raktavarnaa trilochanaa Khatvaangaadipraharanaa vadanaikasamanvitaa Paayasaannapriyaa tvaksthaa pashulokabhayankaree Amritaadimahaashaktisamvritaa daakineeshvaree	Dakinishvari dwells in Vishuddhi and the skin: red, three-eyed, with one face and a skull-staff, fond of milk-rice and fearsome to bound beings.
अनाहताब्जनिलया श्यामाभा वदनद्वया दंष्ट्रोज्ज्वलाक्षमालादिधरा रुधिरसंस्थिता कालरात्र्यादिशक्त्यौघवृता स्निग्धौदनप्रिया महावीरेन्द्रवरदा राकिण्यम्बास्वरूपिणी Anaahataabjanilayaa shyaamaabhaa vadanadvayaa Damshtrojjvalaakshamaalaadidharaa rudhirasamsthitaa Kaalaraatryaadishaktyaughavritaa snigdhaudanapriyaa Mahaaveerendravaradaa raakinyambaasvaroopinee	Mother Rakini dwells in Anahata and the blood, dark and two-faced with shining fangs. Surrounded by Shaktis, she favors rich rice and blesses the foremost heroes.
मणिपूराब्जनिलया वदनत्रयसंयुता वज्रादिकायुधोपेता डामर्यादिभिरावृता रक्तवर्णा मांसनिष्ठा गुडान्नप्रीतमानसा समस्तभक्तसुखदा लाकिन्यम्बास्वरूपिणी Manipooraabjanilayaa vadanatrayasamyutaa Vajraadikaayudhopetaa daamaryaadibhiraavritaa Raktavarnaa maamsanishthaa gudaannapreetamaanasaa Samastabhaktasukhadaa laakinyambaasvaroopinee	Red, three-faced Mother Lakini dwells in Manipura and the flesh. Armed and attended by Shaktis, she loves jaggery-rice and brings happiness to all devotees.
स्वाधिष्ठानाम्बुजगता चतुर्वक्त्रमनोहरा शूलाद्यायुधसम्पन्ना पीतवर्णातिगर्विता मेदोनिष्ठा मधुप्रीता बन्धिन्यादिसमन्विता दध्यन्नासक्तहृदया काकिनीरूपधारिणी Svaadhishthaanaambujagataa chaturvaktramanoharaa Shoolaadyaayudhasampannaa peetavarnaatigarvitaa Medonishthaa madhupreetaa bandhinyaadisamanvitaa Dadhyannaasaktahridayaa kaakineeroopadhaarinee	Yellow, four-faced Kakini dwells in Svadhishthana and bodily fat. Proud, armed, and attended by Shaktis, she delights in honey and yogurt-rice.
मूलाधाराम्बुजारूढा पञ्चवक्त्रास्थिसंस्थिता अङ्कुशादिप्रहरणा वरदादिनिषेविता मुद्गौदनासक्तचित्ता साकिन्यम्बास्वरूपिणी Moolaadhaaraambujaaroodhaa panchavaktraasthisamsthitaa Ankushaadipraharanaa varadaadinishevitaa Mudgaudanaasaktachittaa saakinyambaasvaroopinee	Five-faced Mother Sakini dwells in Muladhara and bone, bears a goad, is served by Varada and others, and loves mung-bean rice.
आज्ञा चक्राब्ज निलया शुक्लवर्णा षडानना मज्जासंस्था हंसवती मुख्यशक्ति समन्विता हरिद्रान्नैक रसिका हाकिनी रूपधारिणी Aajnyaa chakraabja nilayaa shuklavarnaa shadaananaa Majjaasamsthaa hamsavatee mukhyashakti samanvitaa Haridraannaika rasikaa haakinee roopadhaarinee	As Hakini, she dwells in the Ajna lotus, white and six-faced. She resides in marrow, is accompanied by Shaktis led by Hamsavati, and especially delights in turmeric-rice.
सहस्रदल पद्मस्था सर्ववर्णोपशोभिता सर्वायुधधरा शुक्लसंस्थिता सर्वतोमुखी सर्वौदनप्रीतचित्ता याकिन्यम्बा स्वरूपिणी Sahasradala padmasthaa sarvavarnopashobhitaa Sarvaayudhadharaa shuklasamsthitaa sarvatomukhee Sarvaudanapreetachittaa yaakinyambaa svaroopinee	As Mother Yakini, she dwells in the thousand-petalled lotus, radiant in every color, bearing every weapon and facing every direction. She resides in semen and delights in every kind of rice offering.
स्वाहा स्वधा मतिर्मेधा श्रुतिः स्मृतिरनुत्तमा Svaahaa svadhaa matirmedhaa shrutih smritiranuttamaa	She is Svaha and Svadha, the invocations for offerings to gods and ancestors; ignorance, understanding, revealed scripture, remembered sacred tradition, and the unsurpassed.
पुण्यकीर्तिः पुण्यलभ्या पुण्यश्रवण कीर्तना पुलोमजार्चिता बन्धमोचनी बर्बरालका Punyakeertih punyalabhyaa punyashravana keertanaa Pulomajaarchitaa bandhamochanee barbaraalakaa	Her renown is holy; she is reached through merit, and hearing or singing her praise is meritorious. She is worshipped by Pulomaja, frees beings from bondage, and has curling locks of hair.
विमर्शरूपिणी विद्या वियदादि जगत्प्रसूः सर्वव्याधिप्रशमनी सर्वमृत्यु निवारिणी Vimarsharoopinee vidyaa viyadaadi jagatprasooh Sarvavyaadhiprashamanee sarvamrityu nivaarinee	She is Vimarsha, awareness reflecting upon itself, and knowledge; she gives birth to the universe, beginning with space. She calms every disease and wards off every death.
अग्रगण्याऽचिन्त्यरूपा कलिकल्मषनाशिनी कात्यायनी कालहन्त्री कमलाक्षनिषेविता Agraganyaachintyaroopaa kalikalmashanaashinee Kaatyaayanee kaalahantree kamalaakshanishevitaa	She is foremost, with a form beyond thought, and destroys the stains of the Kali age. She is Katyayani, destroyer of time and death, served by lotus-eyed Vishnu.
ताम्बूलपूरितमुखी दाडिमीकुसुमप्रभा मृगाक्षी मोहिनी मुख्या मृडानी मित्ररूपिणी Taamboolapooritamukhee daadimeekusumaprabhaa Mrigaakshee mohinee mukhyaa mridaanee mitraroopinee	Her mouth is filled with betel, and she glows like a pomegranate blossom. Deer-eyed, enchanting, and foremost, she is Mridani, Shiva's consort, and takes the form of a friend.
नित्यतृप्ता भक्तनिधिर्नियन्त्री निखिलेश्वरी मैत्र्यादिवासनालभ्या महाप्रलयसाक्षिणी Nityatriptaa bhaktanidhirniyantree nikhileshvaree Maitryaadivaasanaalabhyaa mahaapralayasaakshinee	Forever content, she is her devotees' treasure, the ruler and sovereign of all. She is reached through inner dispositions such as friendliness and witnesses the great cosmic dissolution.
पराशक्तिः परानिष्ठा प्रज्ञानघनरूपिणी माध्वीपानालसा मत्ता मातृकावर्णरूपिणी Paraashaktih paraanishthaa prajnyaanaghanaroopinee Maadhveepaanaalasaa mattaa maatrikaavarnaroopinee	She is supreme power, the highest abiding state, and undivided consciousness. Languid from drinking sweet wine and intoxicated, she has the form of the Matrika letters, the sacred alphabet.
महाकैलासनिलया मृणालमृदुदोर्लता महनीया दयामूर्तिर्महासाम्राज्यशालिनी Mahaakailaasanilayaa mrinaalamridudorlataa Mahaneeyaa dayaamoortirmahaasaamraajyashaalinee	She dwells on great Kailasa, her arms like creepers as soft as lotus stalks. Worthy of veneration and compassion embodied, she possesses a vast sovereignty.
आत्मविद्या महाविद्या श्रीविद्या कामसेविता श्रीषोडशाक्षरीविद्या त्रिकूटा कामकोटिका Aatmavidyaa mahaavidyaa shreevidyaa kaamasevitaa Shreeshodashaakshareevidyaa trikootaa kaamakotikaa	Lalita is knowledge of the Self and Shrividya, worshipped by Kama; she embodies the sixteen-syllable mantra and includes supreme Shiva as one aspect.
कटाक्षकिङ्करीभूत कमलाकोटिसेविता Kataakshakinkareebhoota kamalaakotisevitaa	She is served by millions upon millions of Kamalas, Lakshmis made her handmaids by her sidelong glance.
शिरःस्थिता चन्द्रनिभा भालस्थेन्द्रधनुःप्रभा हृदयस्था रविप्रख्या त्रिकोणान्तरदीपिका Shirahsthitaa chandranibhaa bhaalasthendradhanuhprabhaa Hridayasthaa raviprakhyaa trikonaantaradeepikaa	She dwells in the head, shining like the moon, and in the forehead, bright as a rainbow. She abides in the heart, radiant as the sun, the lamp within the triangle.
दाक्षायणी दैत्यहन्त्री दक्षयज्ञविनाशिनी Daakshaayanee daityahantree dakshayajnyavinaashinee	She is Dakshayani, Daksha's daughter, slayer of daityas, and destroyer of Daksha's sacrifice.
दरान्दोलितदीर्घाक्षी दरहासोज्ज्वलन्मुखी गुरुमूर्तिर्गुणनिधिर्गोमाता गुहजन्मभूः Daraandolitadeerghaakshee darahaasojjvalanmukhee Gurumoortirgunanidhirgomaataa guhajanmabhooh	Her long eyes move gently, and a slight smile brightens her face. She embodies the guru, is a treasure of virtues, is mother of cows, and is the mother from whom Guha is born.
देवेशी दण्डनीतिस्था दहराकाशरूपिणी प्रतिपन्मुख्यराकान्ततिथिमण्डलपूजिता Deveshee dandaneetisthaa daharaakaasharoopinee Pratipanmukhyaraakaantatithimandalapoojitaa	Queen of the gods, Lalita embodies governance and the heart's subtle space; the lunar-day goddesses worship her through the full moon.
कलात्मिका कलानाथा काव्यालापविनोदिनी सचामररमावाणीसव्यदक्षिणसेविता Kalaatmikaa kalaanaathaa kaavyaalaapavinodinee Sachaamararamaavaaneesavyadakshinasevitaa	She embodies the arts and rules them, delighting in the speaking of poetry. Rama and Vani—Lakshmi and Sarasvati—attend her on either side with fly-whisks.
आदिशक्तिरमेयात्मा परमा पावनाकृतिः अनेककोटिब्रह्माण्डजननी दिव्यविग्रहा Aadishaktirameyaatmaa paramaa paavanaakritih Anekakotibrahmaandajananee divyavigrahaa	She is the primordial Shakti, the immeasurable Self, the supreme one whose form purifies. She gives birth to countless millions of universes and bears a divine body.
क्लीङ्कारी केवला गुह्या कैवल्यपददायिनी त्रिपुरा त्रिजगद्वन्द्या त्रिमूर्तिस्त्रिदशेश्वरी Kleenkaaree kevalaa guhyaa kaivalyapadadaayinee Tripuraa trijagadvandyaa trimoortistridasheshvaree	She takes the form of the sacred syllable Klim: absolute, hidden, and giver of liberation. She is Tripura, honored in the three worlds, the threefold divine form, and sovereign of the gods.
त्र्यक्षरी दिव्यगन्धाढ्या सिन्दूरतिलकाञ्चिता उमाशैलेन्द्रतनया गौरी गन्धर्वसेविता Tryaksharee divyagandhaadhyaa sindooratilakaanchitaa Umaashailendratanayaa gauree gandharvasevitaa	She is the three-syllabled one, rich in divine fragrance and adorned with a vermilion forehead mark. She is Uma, daughter of the mountain king, fair Gauri, attended by the celestial Gandharvas.
विश्वगर्भा स्वर्णगर्भा वरदा वागधीश्वरी Vishvagarbhaa svarnagarbhaa varadaa vaagadheeshvaree	She carries the universe in her womb and has a golden womb; she cuts down the wicked asuras and rules speech.
ध्यानगम्या परिच्छेद्या ज्ञानदा ज्ञानविग्रहा Dhyaanagamyaa parichchhedyaa jnyaanadaa jnyaanavigrahaa	She is reached through meditation and cannot be delimited; she gives knowledge and embodies knowledge.
सर्ववेदान्तसंवेद्या सत्यानन्दस्वरूपिणी लोपामुद्रार्चिता लीलाक्लृप्तब्रह्माण्डमण्डला Sarvavedaantasamvedyaa satyaanandasvaroopinee Lopaamudraarchitaa leelaaklriptabrahmaandamandalaa	She is known through all Vedanta and is truth and bliss in form. Lopamudra worships her; she fashions the multitude of universes as her play.
अदृश्या दृश्यरहिता विज्ञात्री वेद्यवर्जिता योगिनी योगदा योग्या योगानन्दा युगन्धरा Adrishyaa drishyarahitaa vijnyaatree vedyavarjitaa Yoginee yogadaa yogyaa yogaanandaa yugandharaa	She is unseen and free of anything seen, the knower with no separate object to know. She is Yogini, giver of yoga, worthy of attainment, the bliss of yoga, and sustainer of the ages.
इच्छाशक्तिज्ञानशक्तिक्रियाशक्तिस्वरूपिणी सर्वाधारा सुप्रतिष्ठा सदसद्रूपधारिणी Ichchhaashaktijnyaanashaktikriyaashaktisvaroopinee Sarvaadhaaraa supratishthaa sadasadroopadhaarinee	She is the power of willing, the power of knowing, and the power of acting. She supports everything, is firmly established, and bears the forms of both being and nonbeing.
अष्टमूर्तिरजाजैत्री लोकयात्राविधायिनी एकाकिनी भूमरूपा निर्द्वैता द्वैतवर्जिता Ashtamoortirajaajaitree lokayaatraavidhaayinee Ekaakinee bhoomaroopaa nirdvaitaa dvaitavarjitaa	She has eight forms, conquers Aja, primordial nature, and orders the course of the world. She stands alone as limitless fullness, without a second and free of duality.
अन्नदा वसुदा वृद्धा ब्रह्मात्मैक्यस्वरूपिणी बृहती ब्राह्मणी ब्राह्मी ब्रह्मानन्दा बलिप्रिया Annadaa vasudaa vriddhaa brahmaatmaikyasvaroopinee Brihatee braahmanee braahmee brahmaanandaa balipriyaa	She gives food and wealth, is ancient, and embodies the oneness of Brahman and the Self. Vast in being, she is Brahmani and Brahmi, the bliss of Brahman, and lover of sacrificial offerings.
भाषारूपा बृहत्सेना भावाभावविवर्जिता सुखाराध्या शुभकरी शोभना सुलभा गतिः Bhaashaaroopaa brihatsenaa bhaavaabhaavavivarjitaa Sukhaaraadhyaa shubhakaree shobhanaa sulabhaa gatih	She is language itself, commands a great army, and transcends both existence and nonexistence. Easily worshipped, she brings good, is beautiful and readily reached, and is the final goal.
राजराजेश्वरी राज्यदायिनी राज्यवल्लभा राजत्कृपा राजपीठनिवेशितनिजाश्रिता Raajaraajeshvaree raajyadaayinee raajyavallabhaa Raajatkripaa raajapeethaniveshitanijaashritaa	She is Rajarajeshvari, sovereign over kings, who grants kingdoms and cherishes sovereignty. Her grace shines; she seats those who take refuge in her upon a royal throne.
राज्यलक्ष्मीः कोशनाथा चतुरङ्गबलेश्वरी साम्राज्यदायिनी सत्यसन्धा सागरमेखला Raajyalakshmeeh koshanaathaa chaturangabaleshvaree Saamraajyadaayinee satyasandhaa saagaramekhalaa	She is the splendor of kingship, mistress of the treasury, and ruler of the fourfold army. She grants empire, keeps her word, and wears the ocean as her girdle.
दीक्षिता दैत्यशमनी सर्वलोकवशङ्करी सर्वार्थदात्री सावित्री सच्चिदानन्दरूपिणी Deekshitaa daityashamanee sarvalokavashankaree Sarvaarthadaatree saavitree sachchidaanandaroopinee	She is consecrated, subdues the Daityas, and brings all worlds under her sway. She grants every aim, is Savitri, and has the form of being, consciousness, and bliss.
देशकालापरिच्छिन्ना सर्वगा सर्वमोहिनी सरस्वती शास्त्रमयी गुहाम्बा गुह्यरूपिणी Deshakaalaaparichchhinnaa sarvagaa sarvamohinee Sarasvatee shaastramayee guhaambaa guhyaroopinee	She is unbounded by place and time, present everywhere, and enchantress of all. She is Sarasvati, the embodiment of sacred learning, mother of Guha, and hidden in her nature.
सर्वोपाधिविनिर्मुक्ता सदाशिवपतिव्रता सम्प्रदायेश्वरी साध्वी गुरुमण्डलरूपिणी Sarvopaadhivinirmuktaa sadaashivapativrataa Sampradaayeshvaree saadhvee gurumandalaroopinee	She is free of every limiting condition and faithful to Sadashiva as her husband. She rules the sacred tradition, is virtuous, and embodies the whole circle of teachers.
कुलोत्तीर्णा भगाराध्या माया मधुमती मही गणाम्बा गुह्यकाराध्या कोमलांगी गुरुप्रिया Kulotteernaa bhagaaraadhyaa maayaa madhumatee mahee Ganaambaa guhyakaaraadhyaa komalaangee gurupriyaa	Beyond Kula, she receives worship in the solar sphere and is Maya, honey-sweet Madhumati, and the earth. She mothers the divine hosts, receives the Guhyakas’ worship, has tender limbs, and is dear to the guru.
स्वतन्त्रा सर्वतंत्रेशी दक्षिणामूर्तिरूपिणी सनकादि समाराध्या शिवज्ञानप्रदायिनी Svatantraa sarvatantreshee dakshinaamoortiroopinee Sanakaadi samaaraadhyaa shivajnyaanapradaayinee	Independent and sovereign over every Tantra, she takes the form of Dakshinamurti. Sanaka and the other sages worship her, and she grants knowledge of Shiva.
चित्कलानन्दकलिका प्रेमरूपा प्रियंकरी नाम पारायणप्रीता नन्दिविद्यानटेश्वरी Chitkalaanandakalikaa premaroopaa priyankaree Naama paaraayanapreetaa nandividyaanateshvaree	She is a spark of consciousness, a bud of bliss, love embodied, and giver of delight. She loves the recitation of her names, is Nandi’s sacred knowledge, and is Nateshvari, mistress of dance.
मिथ्या जगदधिष्ठाना मुक्तिदा मुक्तिरूपिणी लास्यप्रियालयकरी लज्जारम्भादिवंदिता Mithyaa jagadadhishthaanaa muktidaa muktiroopinee Laasyapriyaalayakaree lajjaarambhaadivanditaa	She is the foundation of the unreal world, gives liberation, and is liberation itself. She loves the graceful lasya dance, brings dissolution, is modesty, and is honored by Rambha and the other celestial women.
भवदावसुधा वृष्टिः पापारण्यदवानला दौर्भाग्यतूलवातूला जराध्वान्तरविप्रभा Bhavadaavasudhaa vrishtih paapaaranyadavaanalaa Daurbhaagyatoolavaatoolaa jaraadhvaantaraviprabhaa	She is praised as nectar-rain that quenches worldly suffering, fire that burns sin, wind that scatters misfortune, and sunlight against the darkness of old age.
भाग्याब्धिचन्द्रिका भक्तचित्तकेकीघनाघना रोगपर्वतदम्भोलिर्मृत्युदारुकुठारिका Bhaagyaabdhichandrikaa bhaktachittakekeeghanaaghanaa Rogaparvatadambholirmrityudaarukuthaarikaa	She nourishes good fortune and delights devotees, like moonlight over an ocean and rainclouds greeting a peacock. She is praised as a thunderbolt against disease and an axe against death.
महेश्वरी महाकाली महाग्रासा महाशना अपर्णा चण्डिका चण्डमुण्डासुरनिषूदिनी Maheshvaree mahaakaalee mahaagraasaa mahaashanaa Aparnaa chandikaa chandamundaasuranishoodinee	She is Maheshvari and Mahakali, a great devourer with an immense appetite. She is Aparna and Chandika, who strikes down the demons Chanda and Munda.
क्षराक्षरात्मिका सर्वलोकेशी विश्वधारिणी त्रिवर्गदात्री सुभगा त्र्यम्बका त्रिगुणात्मिका Ksharaaksharaatmikaa sarvalokeshee vishvadhaarinee Trivargadaatree subhagaa tryambakaa trigunaatmikaa	She is the perishable and imperishable reality, ruling and sustaining all worlds. She grants right conduct, prosperity, and fulfilled desire; auspicious and three-eyed, she embodies nature’s three qualities.
स्वर्गापवर्गदा शुद्धा जपापुष्पनिभाकृतिः ओजोवती द्युतिधरा यज्ञरूपा प्रियव्रता Svargaapavargadaa shuddhaa japaapushpanibhaakritih Ojovatee dyutidharaa yajnyaroopaa priyavrataa	She grants heaven and liberation, is pure, and has a form like a hibiscus blossom. Full of vitality and radiance, she is the sacrificial rite itself and loves sacred vows.
दुराराध्या दुराधर्षा पाटलीकुसुमप्रिया महती मेरुनिलया मन्दारकुसुमप्रिया Duraaraadhyaa duraadharshaa paataleekusumapriyaa Mahatee merunilayaa mandaarakusumapriyaa	She is difficult to worship and hard to overcome, and loves patali blossoms. Great in being, she dwells on Meru and loves mandara flowers.
वीराराध्या विराड्रूपा विरजा विश्वतोमुखी प्रत्यग्रूपा पराकाशा प्राणदा प्राणरूपिणी Veeraaraadhyaa viraadroopaa virajaa vishvatomukhee Pratyagroopaa paraakaashaa praanadaa praanaroopinee	Heroic devotees worship her. Her body is the cosmic whole; she is stainless and faces every direction. She is the inward Self and the supreme expanse, giving life and being life itself.
मार्ताण्ड भैरवाराध्या मन्त्रिणी न्यस्त राज्यधूः त्रिपुरेशी जयत्सेना निस्त्रैगुण्या परापरा Maartaanda bhairavaaraadhyaa mantrinee nyasta raajyadhooh Tripureshee jayatsenaa nistraigunyaa paraaparaa	Worshipped by Martanda Bhairava, she entrusts her kingdom to Mantrini. As Tripureshi she commands a victorious army; beyond nature’s three qualities, she is both higher and lower reality.
सत्यज्ञानानन्दरूपा सामरस्य परायणा कपर्दिनी कलामाला कामधुक् कामरूपिणी Satyajnyaanaanandaroopaa saamarasya paraayanaa Kapardinee kalaamaalaa kaamadhuk kaamaroopinee	She is truth, knowledge, and bliss in perfect oneness: matted-haired and garlanded with the arts, granting desires and assuming whatever form she wills.
कलानिधिः काव्यकला रसज्ञा रसशेवधिः पुष्टा पुरातना पूज्या पुष्करा पुष्करेक्षणा Kalaanidhih kaavyakalaa rasajnyaa rasashevadhih Pushtaa puraatanaa poojyaa pushkaraa pushkarekshanaa	She is the treasury of the arts and the art of poetry; she knows rasa, the savor of experience, and is its treasure. Flourishing, ancient, and worthy of worship, she nourishes and has lotus eyes.
परंज्योतिः परंधाम परमाणुः परात्परा पाशहस्ता पाशहन्त्री परमन्त्र विभेदिनी Paranjyotih parandhaama paramaanuh paraatparaa Paashahastaa paashahantree paramantra vibhedinee	She is supreme light, the highest abode, the tiniest particle, and beyond even the highest. She holds a noose, destroys bonds, and breaks the force of hostile mantras.
मूर्तामूर्ता नित्यतृप्ता मुनि मानस हंसिका सत्यव्रता सत्यरूपा सर्वान्तर्यामिणी सती Moortaamoortaa nityatriptaa muni maanasa hamsikaa Satyavrataa satyaroopaa sarvaantaryaaminee satee	She has form and is formless, is always content, and is a swan in the minds of sages. Truth is her vow and her very form; she dwells within all and is Sati.
ब्रह्माणी ब्रह्मजननी बहुरूपा बुधार्चिता प्रसवित्री प्रचण्डाज्ञा प्रतिष्ठा प्रकटाकृतिः Brahmaanee brahmajananee bahuroopaa budhaarchitaa Prasavitree prachandaajnyaa pratishthaa prakataakritih	She is Brahmani, mother of Brahma, manifold in form and worshipped by the wise. She brings beings to birth, is fierce, and is the divine command itself. She is the foundation and bears a manifest form.
प्राणेश्वरी प्राणदात्री पञ्चाशत्पीठरूपिणी विशृङ्खला विविक्तस्था वीरमाता वियत्प्रसूः Praaneshvaree praanadaatree panchaashatpeetharoopinee Vishrinkhalaa viviktasthaa veeramaataa viyatprasooh	She rules the vital breath, gives life, and embodies the fifty sacred seats. Unfettered and dwelling in seclusion, she is mother of heroes and gives birth to space.
मुकुन्दा मुक्तिनिलया मूलविग्रहरूपिणी भावज्ञा भवरोगघ्नी भवचक्रप्रवर्तिनी Mukundaa muktinilayaa moolavigraharoopinee Bhaavajnyaa bhavarogaghnee bhavachakrapravartinee	She is Mukunda, giver of release, the dwelling of liberation, and the original divine form. She knows the heart’s dispositions, destroys the disease of repeated existence, and sets the wheel of existence turning.
छन्दस्सारा शास्त्रसारा मन्त्रसारा तलोदरी उदारकीर्ति रुद्दामवैभवा वर्णरूपिणी Chhandassaaraa shaastrasaaraa mantrasaaraa talodaree Udaarakeerti ruddaamavaibhavaa varnaroopinee	She is the essence of Vedic verse, sacred teaching, and mantra, and has a slender belly. Her fame is noble, her splendor unbounded, and her form is the letters of speech.
जन्ममृत्युजरातप्तजनविश्रान्तिदायिनी सर्वोपनिषदुद्घुष्टा शान्त्यतीतकलात्मिका Janmamrityujaraataptajanavishraantidaayinee Sarvopanishadudghushtaa shaantyateetakalaatmikaa	She gives rest to people scorched by birth, death, and old age. All the Upanishads proclaim her; she embodies Shantyatita, the sacred level beyond peace.
गम्भीरा गगनान्तस्था गर्विता गानलोलुपा Gambheeraa gaganaantasthaa garvitaa gaanalolupaa	She is unfathomably deep, dwells within the vast sky, is proud, and longs for song.
कल्पनारहिता काष्ठा कान्ता कान्तार्धविग्रहा Kalpanaarahitaa kaashthaa kaantaa kaantaardhavigrahaa	She is free from imagined distinctions, the ultimate limit, the one who ends sin and suffering, and one whose body is half her beloved’s.
कार्यकारणनिर्मुक्ता कामकेलि तरङ्गिता कनत्कनक ताटङ्का लीला विग्रह धारिणी Kaaryakaarananirmuktaa kaamakeli tarangitaa Kanatkanaka taatankaa leelaa vigraha dhaarinee	She is free of cause and effect and surges with erotic play. She wears gleaming gold earrings and assumes bodily form as divine play.
अजाक्षय विनिर्मुक्ता मुग्धा क्षिप्र प्रसादिनी अन्तर्मुखसमाराध्या बहिर्मुखसुदुर्लभा Ajaakshaya vinirmuktaa mugdhaa kshipra prasaadinee Antarmukhasamaaraadhyaa bahirmukhasudurlabhaa	Unborn and free from decay, she is enchanting and quickly gracious. She is well worshipped by those who turn inward, and very hard to find for those turned outward.
त्रयी त्रिवर्गनिलया त्रिस्था त्रिपुरमालिनी निरामया निरालम्बा स्वात्माराम सुधास्रुतिः Trayee trivarganilayaa tristhaa tripuramaalinee Niraamayaa niraalambaa svaatmaaraama sudhaasrutih	She is the threefold Vedic wisdom, home of life’s three aims, present in the three worlds, and Tripuramalini. Free of illness and dependent on nothing, she delights in her own Self and streams forth as nectar.
संसारपङ्कनिर्मग्न समुद्धरणपण्डिता यज्ञप्रिया यज्ञकर्त्री यजमानस्वरूपिणी Samsaarapankanirmagna samuddharanapanditaa Yajnyapriyaa yajnyakartree yajamaanasvaroopinee	She is skilled at lifting those sunk in the mud of samsara, the cycle of worldly existence. She loves sacrifice, performs it, and is herself the one who sponsors it.
धर्माधारा धनाध्यक्षा धनधान्यविवर्धिनी विप्रप्रिया विप्ररूपा विश्वभ्रमणकारिणी Dharmaadhaaraa dhanaadhyakshaa dhanadhaanyavivardhinee Viprapriyaa vipraroopaa vishvabhramanakaarinee	She supports dharma, oversees wealth, and increases riches and grain. Brahmins are dear to her, and she takes their form; she causes the world to revolve.
विश्वग्रासा विद्रुमाभा वैष्णवी विष्णुरूपिणी अयोनिर्योनि निलया कूटस्था कुलरूपिणी Vishvagraasaa vidrumaabhaa vaishnavee vishnuroopinee Ayoniryoni nilayaa kootasthaa kularoopinee	She devours the universe and gleams like coral; she is Vaishnavi and the form of Vishnu. Born from no womb, she dwells in the womb, remains unchanged, and embodies Kula.
वीरगोष्ठीप्रिया वीरा नैष्कर्म्या नादरूपिणी विज्ञानकलना कल्या विदग्धा बैन्दवासना Veeragoshtheepriyaa veeraa naishkarmyaa naadaroopinee Vijnyaanakalanaa kalyaa vidagdhaa baindavaasanaa	Heroic and delighted by heroic devotees, she is freedom from action and primal sound. She realizes knowledge, is auspicious and accomplished, and is seated at the sacred bindu.
तत्त्वाधिका तत्त्वमयी तत्त्वमर्थस्वरूपिणी सामगानप्रिया सौम्या सदाशिवकुटुम्बिनी Tattvaadhikaa tattvamayee tattvamarthasvaroopinee Saamagaanapriyaa saumyaa sadaashivakutumbinee	She transcends the principles of reality, embodies reality, and is what is meant by “That” and “you.” She loves Sama-Veda chant, is gentle, and is Sadashiva’s consort.
सव्यापसव्यमार्गस्था सर्वापद्विनिवारिणी स्वस्था स्वभावमधुरा धीरा धीरसमर्चिता Savyaapasavyamaargasthaa sarvaapadvinivaarinee Svasthaa svabhaavamadhuraa dheeraa dheerasamarchitaa	She abides in both the right and left paths and removes every danger. Established in her own being and naturally sweet, she is steadfast and worshipped by the steadfast wise.
चैतन्यार्घ्यसमाराध्या चैतन्यकुसुमप्रिया सदोदिता सदातुष्टा तरूणादित्यपाटला Chaitanyaarghyasamaaraadhyaa chaitanyakusumapriyaa Sadoditaa sadaatushtaa taroonaadityapaatalaa	She is worshipped with consciousness as the welcoming offering, and loves the flower of consciousness. Ever arising and always content, she is rosy like the young sun.
दक्षिणादक्षिणाराध्या दरस्मेरमुखाम्बुजा कौलिनी केवलानर्घ्यकैवल्यपददायिनी Dakshinaadakshinaaraadhyaa darasmeramukhaambujaa Kaulinee kevalaanarghyakaivalyapadadaayinee	She is worshipped through both right and left approaches, and her lotus face smiles gently. She is the absolute Kaulini and grants the priceless state of liberation.
स्तोत्रप्रिया स्तुतिमती श्रुतिसंस्तुतवैभवा मनस्विनी मानवती महेशी मङ्गलाकृतिः Stotrapriyaa stutimatee shrutisamstutavaibhavaa Manasvinee maanavatee maheshee mangalaakritih	She loves hymns, is worthy of praise, and has her glory acclaimed by the Vedas. Strong in mind and honored, she is Maheshi, the great sovereign, whose very form is auspicious.
विश्वमाता जगद्धात्री विशालाक्षी विरागिणी प्रगल्भा परमोदारा परामोदा मनोमयी Vishvamaataa jagaddhaatree vishaalaakshee viraaginee Pragalbhaa paramodaaraa paraamodaa manomayee	Mother of the universe and sustainer of the world, she is wide-eyed and free from attachment. Confident and supremely generous, she is supreme delight and has the form of mind.
व्योमकेशी विमानस्था वज्रिणी वामकेश्वरी पञ्चयज्ञप्रिया पञ्चप्रेतमञ्चाधिशायिनी Vyomakeshee vimaanasthaa vajrinee vaamakeshvaree Panchayajnyapriyaa panchapretamanchaadhishaayinee	The sky is her hair; she sits in a celestial vehicle, bears the thunderbolt, and is Vamakeshvari. She loves the five great sacrifices and reclines upon a couch made of five corpses.
पञ्चमी पञ्चभूतेशी पञ्चसङ्ख्योपचारिणी शाश्वती शाश्वतैश्वर्या शर्मदा शम्भुमोहिनी Panchamee panchabhooteshee panchasankhyopachaarinee Shaashvatee shaashvataishvaryaa sharmadaa shambhumohinee	She is Panchami, the fifth, ruler of the five elements, honored with five offerings. Eternal and eternally sovereign, she gives well-being and enchants Shambhu.
धराधरासुता धन्या धर्मिणी धर्मवर्धिनी लोकातीता गुणातीता सर्वातीता शमात्मिका Dharaadharaasutaa dhanyaa dharminee dharmavardhinee Lokaateetaa gunaateetaa sarvaateetaa shamaatmikaa	She is the mountain’s daughter, blessed, righteous, and increaser of dharma. Beyond the worlds, beyond nature’s qualities, and beyond all, she is tranquility itself.
बन्धूककुसुमप्रख्या बाला लीलाविनोदिनी सुमङ्गलि सुखकरी सुवेषाढ्या सुवासिनी Bandhookakusumaprakhyaa baalaa leelaavinodinee Sumangali sukhakaree suveshaadhyaa suvaasinee	She glows like the red bandhuka blossom, is Bala, the young one, and delights in play. She is the auspicious married woman, brings happiness, is richly dressed, and is Suvasini, whose husband lives.
सुवासिन्यर्चनप्रीता शोभना शुद्धमानसा बिन्दुतर्पणसन्तुष्टा पूर्वजा त्रिपुराम्बिका Suvaasinyarchanapreetaa shobhanaa shuddhamaanasaa Bindutarpanasantushtaa poorvajaa tripuraambikaa	She is pleased by worship offered to Suvasinis, auspiciously married women; she is beautiful and pure in mind. Offerings at the sacred bindu satisfy her; she is the firstborn and Tripurambika, Mother of the three cities.
दशमुद्रासमाराध्या त्रिपुराश्रीवशङ्करी ज्ञानमुद्रा ज्ञानगम्या ज्ञानज्ञेयस्वरूपिणी Dashamudraasamaaraadhyaa tripuraashreevashankaree Jnyaanamudraa jnyaanagamyaa jnyaanajnyeyasvaroopinee	She is worshipped with ten sacred gestures and holds Tripurashri under her sway. She is the gesture of knowledge, is reached through knowledge, and is both knowledge and what is known.
योनिमुद्रा त्रिखण्डेशी त्रिगुणाम्बा त्रिकोणगा अनघाद्भुत चारित्रा वाञ्छितार्थ प्रदायिनी Yonimudraa trikhandeshee trigunaambaa trikonagaa Anaghaadbhuta chaaritraa vaanchhitaartha pradaayinee	She is the yoni gesture, sign of the womb; she rules the three divisions, embodies the three qualities, and is the Mother dwelling in the triangle. Sinless and wondrous in her deeds, she grants what is desired.
अभ्यासातिशयज्ञाता षडध्वातीतरूपिणी अव्याजाकरुणामूर्तिरज्ञानध्वान्तदीपिका Abhyaasaatishayajnyaataa shadadhvaateetaroopinee Avyaajaakarunaamoortirajnyaanadhvaantadeepikaa	She is known through sustained, deep practice, and her form transcends the six paths. She is unfeigned compassion embodied, a lamp in the darkness of ignorance.
आबालगोपविदिता सर्वानुल्लङ्घ्यशासना श्रीचक्रराजनिलया श्रीमत्त्रिपुरसुन्दरी Aabaalagopaviditaa sarvaanullanghyashaasanaa Shreechakraraajanilayaa shreemattripurasundaree	She is known even to children and cowherds; none can overstep her command. She dwells in Shri Chakra, king of sacred diagrams, and is glorious Tripurasundari, Beauty of the three cities.
श्रीशिवा शिवशक्त्यैक्यरूपिणी ललिताम्बिका Shreeshivaa shivashaktyaikyaroopinee lalitaambikaa	She is Shri Shiva, the auspicious Goddess; she embodies the oneness of Shiva and Shakti, and is Lalitambika, Mother Lalita.
एवं श्रीललितादेव्या नाम्नां साहस्रकं जगुः Evam shreelalitaadevyaa naamnaam saahasrakam jaguh	Thus they sang the thousand names of the Goddess Shri Lalita.
इति श्रीब्रह्माण्डपुराणे श्रीललितासहस्रनामस्तोत्रं सम्पूर्णम् Iti shreebrahmaandapuraane Shreelalitaasahasranaamastotram sampoornam	Thus, in the revered Brahmanda Purana, the Hymn of Shri Lalita's Thousand Names is complete.

Diya's English explains each passage in plain language; it is not a word-for-word translation.

About Lalitha Sahasranamam

Traditionally transmitted in the Brahmanda Purana, Lalitha Sahasranamam is a hymn listing a thousand names of the goddess Lalitha. Its narrative takes the form of a conversation between Hayagriva and the sage Agastya.

In Diya you can listen to mantras, prayers, aartis, bhajans, and devotional recordings, including Lalitha Sahasranamam. Diya is available for iPhone. Try Diya free before subscribing.

Related reading

• Vishnu Sahasranamam Lyrics in English: Full Text
• Aigiri Nandini Lyrics in English (Mahishasura Mardini Stotram)
• Hindu gods and goddesses
• About the Diya app